Mouse EPOR Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85901-1-RR (same clone as 85901-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85901-1-RR (EPOR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85901-1-PBS in a different storage buffer formulation.

EPOR Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85901-1-PBS

Clone No.250056D4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

EPO-R, Erythropoietin receptor

---

Product Information

85901-1-PBS targets EPOR in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2711

  Product name: Recombinant Mouse Epor protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 25-249 aa of NM_010149.3

  Sequence: APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

• Full Name: erythropoietin receptor
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: NM_010149.3
• Gene Symbol: Epor
• Gene ID (NCBI): 13857
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14753-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Erythropoietin (EPO) receptor (EPOR) is a glycoprotein that belongs to the type I superfamily of single-transmembrane cytokine receptors. It consists of an extracellular domain that binds to the EPO ligand, a transmembrane domain and an intracellular domain. The interaction of EPO and EPOR triggers the activation of several signaling pathways that induce erythropoiesis, including JAK2/STAT5, PI3K/AKT, and MAPK (PMID: 34281163). EPOR is present on erythroid progenitor cells and has also been detected on a wide variety of non-hematopoietic cells (PMID: 36233351). The calculated molecular weight of EPOR is 55 kDa. EPOR undergoes posttranslational modification and the apparent molecular weight of 66-78 kDa has been reported (PMID: 8943308; 12088257).