EPX Polyclonal antibody

• 

  WB analysis using 29755-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29755-1-AP (EPX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human hepatocirrhosis using 29755-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 29755-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 29755-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 29755-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using 29755-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using EPX antibody (29755-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

EPX Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 29755-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

EPX/ PERE, eosinophil peroxidase

---

Tested Applications

• Positive WB detected in: pig bone marrow tissue
• Positive IHC detected in: human hepatocirrhosis tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29755-1-AP targets EPX in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30561

  Product name: Recombinant human EPX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 580-673 aa of NM_000502

  Sequence: LSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSR

• Full Name: eosinophil peroxidase
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: NM_000502
• Gene Symbol: EPX
• Gene ID (NCBI): 8288
• RRID: AB_3086154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11678
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Adélaïde (Verified Customer) (05-14-2025)

- Need to permeabilize (Triton) - Secondary antibody Goat anti-rabbit IgG AlexaFluor555 antibody (Life Technologies, Ref no: A21428) (1:500) - DAPI Fluromount-G (SouthernBiotech, Ref no: 0100-20) - Antigen retrieval : Tris-EDTA buffer (10 mM Tris base, 1 mM EDTA solution, 0.05% Tween 20, pH 9.0)

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1/700
• Cell Tissue Type: MOUSE LUNG

EPX Antibody Immunofluorescence validation (1/700 dilution) in MOUSE LUNG (Cat no:29755-1-AP)