Eosinophil peroxidase Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Eosinophil peroxidase Polyclonal antibody (29755-1-AP)

Eosinophil peroxidase Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29755-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, IHC, ELISA

Synonyms

EPX, EPX/ PERE

• 

  WB analysis using 29755-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29755-1-AP (EPX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 29755-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 29755-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 29755-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 29755-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: pig bone marrow tissue
• Positive IHC detected in: human hepatocirrhosis tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29755-1-AP targets Eosinophil peroxidase in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30561

  Product name: Recombinant human EPX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 580-673 aa of NM_000502

  Sequence: LSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSR

• Full Name: eosinophil peroxidase
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: NM_000502
• Gene Symbol: EPX
• Gene ID (NCBI): 8288
• RRID: AB_3086154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11678
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Adélaïde (Verified Customer) (05-14-2025)

- Need to permeabilize (Triton) - Secondary antibody Goat anti-rabbit IgG AlexaFluor555 antibody (Life Technologies, Ref no: A21428) (1:500) - DAPI Fluromount-G (SouthernBiotech, Ref no: 0100-20) - Antigen retrieval : Tris-EDTA buffer (10 mM Tris base, 1 mM EDTA solution, 0.05% Tween 20, pH 9.0)

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1/700
• Cell Tissue Type: MOUSE LUNG

Eosinophil peroxidase Antibody Immunofluorescence validation (1/700 dilution) in MOUSE LUNG (Cat no:29755-1-AP)