ER Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84564-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 84564-1-PBS against Human ER was performed. The affinity constant is 2.62 nM.

ER Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84564-1-PBS

Clone No.241825C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

ESR1, ER alpha, Era, ER-alpha, ERα

---

Product Information

84564-1-PBS targets ER in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2234

  Product name: Recombinant Human ER protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 1-116 aa of BC128573

  Sequence: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

• Full Name: estrogen receptor 1
• Calculated Molecular Weight: 595 aa, 66 kDa
• GenBank Accession Number: BC128573
• Gene Symbol: ER
• Gene ID (NCBI): 2099
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P03372
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.