ERC1 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 66681-1-Ig (same clone as 66681-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66681-1-Ig (ERC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66681-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51549-1

  Cytometric bead array sample test of MP51549-1, ERC1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66681-1-PBS. Detection antibody: 66681-2-PBS.

• 

  Cytometric bead array standard curve of MP51549-1

  Cytometric bead array standard curve of MP51549-1, ERC1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66681-1-PBS. Detection antibody: 66681-2-PBS. Standard:Ag17665. Range: 0.781-100 ng/mL.

ERC1 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 66681-1-PBS

Clone No.2A5B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

ELKS, Cast2, ELKS/Rab6-interacting/CAST family member 1, ERC 1, ERC-1

---

Product Information

66681-1-PBS targets ERC1 as part of a matched antibody pair:

MP51549-1: 66681-1-PBS capture and 66681-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17665

  Product name: Recombinant human ERC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 985-1116 aa of BC132782

  Sequence: DNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPDILEQVVNALEESS

• Full Name: ELKS/RAB6-interacting/CAST family member 1
• Calculated Molecular Weight: 1116 aa, 128 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: BC132782
• Gene Symbol: ERC1
• Gene ID (NCBI): 23085
• RRID: AB_2882035
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8IUD2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ERC is an acronym based on previous separate namings of members of this protein family, ELKS, Rab6IP2 and CAST (PMID: 12391317). They are known to bind RIMs, the active zone proteins that regulate neurotransmitter release. ERC1 (ELKS) is an essential regulatory subunit of the IKK complex and likely functions by recruiting IκBα to the complex (PMID: 15218148). Multiple isoforms of ERC1 mRNA are generated by alternative splicing (PMID: 12203787). There are two known splice variants of ERC1 protein that differ at their C termini, ERC1a and ERC1b. ERC1a is ubiquitously expressed, whereas ERC1b is brain-specific (PMID: 12391317; 12923177).