ERC1 Monoclonal antibody, PBS Only (Capture)

ERC1 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 66681-1-PBS
Clone No.2A5B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

ELKS, Cast2, ELKS/Rab6-interacting/CAST family member 1, ERC 1, ERC-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66681-1-PBS targets ERC1 as part of a matched antibody pair:

MP51549-1: 66681-1-PBS capture and 66681-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17665

Product name: Recombinant human ERC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 985-1116 aa of BC132782

Sequence: DNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPDILEQVVNALEESS

Predict reactive species
Full Name ELKS/RAB6-interacting/CAST family member 1
Calculated Molecular Weight 1116 aa, 128 kDa
Observed Molecular Weight 135 kDa
GenBank Accession NumberBC132782
Gene Symbol ERC1
Gene ID (NCBI) 23085
RRIDAB_2882035
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8IUD2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ERC is an acronym based on previous separate namings of members of this protein family, ELKS, Rab6IP2 and CAST (PMID: 12391317). They are known to bind RIMs, the active zone proteins that regulate neurotransmitter release. ERC1 (ELKS) is an essential regulatory subunit of the IKK complex and likely functions by recruiting IκBα to the complex (PMID: 15218148). Multiple isoforms of ERC1 mRNA are generated by alternative splicing (PMID: 12203787). There are two known splice variants of ERC1 protein that differ at their C termini, ERC1a and ERC1b. ERC1a is ubiquitously expressed, whereas ERC1b is brain-specific (PMID: 12391317; 12923177).

Loading...
||
New chat

Able

正在加载,请稍候...