ERC1 Monoclonal antibody, PBS Only

ERC1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66681-1-PBS
Clone No.2A5B9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, Indirect ELISA

Cast2, ELKS, ERC 1, ERC1, KIAA1081, Rab6 interacting protein 2, RAB6IP2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66681-1-PBS targets ERC1 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17665

Product name: Recombinant human ERC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 985-1116 aa of BC132782

Sequence: DNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPDILEQVVNALEESS

Predict reactive species
Full Name ELKS/RAB6-interacting/CAST family member 1
Calculated Molecular Weight 1116 aa, 128 kDa
Observed Molecular Weight 135 kDa
GenBank Accession NumberBC132782
Gene Symbol ERC1
Gene ID (NCBI) 23085
RRIDAB_2882035
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8IUD2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ERC is an acronym based on previous separate namings of members of this protein family, ELKS, Rab6IP2 and CAST (PMID: 12391317). They are known to bind RIMs, the active zone proteins that regulate neurotransmitter release. ERC1 (ELKS) is an essential regulatory subunit of the IKK complex and likely functions by recruiting IκBα to the complex (PMID: 15218148). Multiple isoforms of ERC1 mRNA are generated by alternative splicing (PMID: 12203787). There are two known splice variants of ERC1 protein that differ at their C termini, ERC1a and ERC1b. ERC1a is ubiquitously expressed, whereas ERC1b is brain-specific (PMID: 12391317; 12923177).

Loading...
||
New chat Able
正在加载,请稍候...