ERCC1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ERCC1 Recombinant monoclonal antibody (87175-3-RR)

• 

  WB analysis using 87175-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87175-3-RR (ERCC1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 87175-3-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ERCC1 antibody (87175-3-RR, Clone: 252372B6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity of 87175-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87175-3-RR against Human ERCC1 were performed. The affinity constant is below 1 pM.

ERCC1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87175-3-RR

Clone No.252372B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

COFS4, DNA excision repair protein ERCC-1, RAD10, UV20

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, SKOV-3 cells, T-47D cells, HCT 116 cells, COLO 320 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87175-3-RR targets ERCC1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6112

  Product name: Recombinant human ERCC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC052813

  Sequence: MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKVRALGKNPRSWGKERAPNKHNLRPQSFKVKKEPKTRHSGFRL

• Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC052813
• Gene Symbol: ERCC1
• Gene ID (NCBI): 2067
• RRID: AB_3745390
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07992
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Excision Repair Cross Complementing 1 (ERCC1) is a structure-specific endonuclease that is responsible for the 5'-incision during DNA repair. It forms a complex with ERCC11, XPF and ERCC4, which are required in both recombinatorial repair and nucleotide excision repair. It has been found that ERCC1, together with RRM1, are determinants of survival after surgical treatment of early-stage, non-small-cell lung cancer. (Ref: Simon, ER. 2005). The calculated molecular weight of ERCC1 is 33 kDa, but the modified ERCC1 is about38 kDa.