XPG Polyclonal antibody

• Home
• Products
• Primary Antibodies
• XPG Polyclonal antibody (11331-1-AP)

• Featured Product
• KD/KO Validated

XPG Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 11331-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

ERCC5, COFS3, DNA excision repair protein ERCC-5, DNA repair protein complementing XP-G cells, EC:3.1.-.-

• 

  WB analysis using 11331-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11331-1-AP (XPG antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11331-1-AP

  WB result of XPG antibody (11331-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-XPG transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11331-1-AP

  IP result of anti-XPG (IP:11331-1-AP, 4ug; Detection:11331-1-AP 1:500) with HeLa cells lysate 1200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11331-1-AP

  Immunofluorescent analysis of HeLa cells using 11331-1-AP (XPG antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for XPG in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Daudi cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11331-1-AP targets XPG in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1874

  Product name: Recombinant human ERCC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 880-1186 aa of BC031522

  Sequence: EFPGHGLEPLLKFSEWWHEAQKNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT

• Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 5
• Calculated Molecular Weight: 1186 aa, 133 kDa
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: BC031522
• Gene Symbol: ERCC5
• Gene ID (NCBI): 2073
• RRID: AB_2098155
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P28715
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human genes correcting DNA repair defects are termed excision-repair cross-complementing or ERCC genes. The ERCC5 gene corrects the excision repair deficiency of Chinese hamster ovary cell line UV135 of complementation group 5. The human ERCC5 gene product is a structure-specific endonuclease required for making the 3-prime incision during DNA nucleotide excision-repair (NER). It also plays an important role in regulating DNA excision repair, removal of bulky lesions caused by environmental chemicals or UV light [PMID:22815677]. The calculated molecular weight of ERCC5 is 133 kDa, but the modified ERCC5 protein is about 200 kDa.

Publications

What published studies show

The XPG Polyclonal antibody (catalog no. 11331-1-AP) has 16 citations. These appear in journals including Cell, Cancer Cell, Science Advances, Cancer Research, Cell Death & Differentiation, Cell Death & Disease, Oncology Reports, iScience, Toxicology, Toxicology and Applied Pharmacology, Molecular Carcinogenesis, Journal of Cancer, Photochemistry and Photobiology, Biochimica et Biophysica Acta, and bioRxiv. The research fields center on DNA damage repair, nucleotide excision repair (NER), R-loop processing, homologous recombination, and cancer biology, including UV-induced DNA damage and cisplatin resistance.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Cancer Cell; Systematic Functional Annotation of Somatic Mutations in Cancer.; Authors - Patrick Kwok-Shing Ng
human	WB	Cell; Human Rad52 Promotes XPG-Mediated R-loop Processing to Initiate Transcription-Associated Homologous Recombination Repair.; Authors - Takaaki Yasuhara ; KD Validated
		Cancer Res; Sustained Aurora Kinase B Expression Confers Resistance to PI3K Inhibition in Head and Neck Squamous Cell Carcinoma; Authors - Pooja A Shah
mouse	IF	Sci Adv; XPF interacts with TOP2B for R-loop processing and DNA looping on actively transcribed genes; Authors - Georgia Chatzinikolaou
human	WB	Cell Death Differ; NKAP acts with HDAC3 to prevent R-loop associated genome instability; Authors - Xing Zhang
human	WB	Cell Death Dis; DNMT3b protects centromere integrity by restricting R-loop-mediated DNA damage.; Authors - Hsueh-Tzu Shih ; KD Validated