ERH Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ERH Polyclonal antibody (15974-1-AP)

• KD/KO Validated

ERH Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15974-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

DROER

• 

  WB analysis using 15974-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15974-1-AP (ERH antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15974-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15974-1-AP (ERH antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 15974-1-AP

  WB result of ERH antibody (15974-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ERH transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 15974-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 15974-1-AP (ERH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 15974-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 15974-1-AP (ERH antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 15974-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15974-1-AP (ERH antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 15974-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15974-1-AP (ERH antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 15974-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 15974-1-AP (ERH antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ERH in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HEK-293 cells, mouse testis tissue, rat liver tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15974-1-AP targets ERH in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8761

  Product name: Recombinant human ERH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-104 aa of BC014301

  Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

• Full Name: enhancer of rudimentary homolog (Drosophila)
• Calculated Molecular Weight: 104 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC014301
• Gene Symbol: ERH
• Gene ID (NCBI): 2079
• RRID: AB_2098556
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P84090
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ERH Polyclonal Antibody (Cat# 15974-1-AP) has 3 total citations published in Acta Pharm Sin B, J Cell Sci, and Biochem Biophys Res Commun. The associated research fields include liver fibrosis and ER stress–mediated IL-17/MAPK11 signaling, viral infection-induced stress granule formation, and nascent transcription regulation involving DGCR8/DROSHA. Cited applications span WB and IF in human and mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse	WB	Acta Pharm Sin B; Hepatic stellate cell enriched Asporin drives liver fibrosis by stabilizing ERH to promote IL-17/MAPK11 signaling.; Authors - Jian Sun
	IF	J Cell Sci; Novel stress granules-like structures are induced via a paracrine mechanism during viral infection.; Authors - Valentina Iadevaia
		Biochem Biophys Res Commun; DGCR8 promotes nascent transcription independently of DROSHA.; Authors - Jin Wang