ERI3 Polyclonal antibody

• 

ERI3 Polyclonal Antibody for ELISA

Cat No. 10548-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

ERI1 exoribonuclease 3, ERI3, exoribonuclease 3, PINT1, Prion interactor 1, PRNPIP, PRNPIP1

---

Product Information

10548-1-AP targets ERI3 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0826

  Product name: Recombinant human ERI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC001072

  Sequence: MVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKPF

• Full Name: exoribonuclease 3
• Calculated Molecular Weight: 15 kDa
• GenBank Accession Number: BC001072
• Gene Symbol: ERI3
• Gene ID (NCBI): 79033
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43414
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.