ERMAP Polyclonal antibody

• 

  IP experiment of MCF-7 using 21375-1-AP

  IP result of anti-ERMAP (IP:21375-1-AP, 4ug; Detection:21375-1-AP 1:300) with MCF-7 cells lysate 1600ug.

• 

  IF Staining of MCF-7 using 21375-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 21375-1-AP (ERMAP antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

ERMAP Polyclonal Antibody for IF/ICC, IP, ELISA

Cat No. 21375-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

ERMAP, hERMAP, PRO2801, Radin blood group antigen, RD, SC, Scianna blood group antigen

---

Tested Applications

• Positive IP detected in: MCF-7 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

21375-1-AP targets ERMAP in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15899

  Product name: Recombinant human ERMAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 176-475 aa of BC099703

  Sequence: IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF

• Full Name: erythroblast membrane-associated protein (Scianna blood group)
• Calculated Molecular Weight: 475 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC099703
• Gene Symbol: ERMAP
• Gene ID (NCBI): 114625
• RRID: AB_2878849
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PL5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Immunol; The ligation between ERMAP, galectin-9 and dectin-2 promotes Kupffer cell phagocytosis and antitumor immunity; Authors - Jie Li