ERMN Monoclonal antibody, PBS Only

• 

  WB analysis using 66605-1-Ig (same clone as 66605-1-PBS)

  Various tissues were subjected to SDS PAGE followed by western blot with 66605-1-Ig (ERMN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66605-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66605-1-Ig (same clone as 66605-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66605-1-Ig (ERMN antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66605-1-PBS in a different storage buffer formulation.

ERMN Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66605-1-PBS

Clone No.2B1C1

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

2B1C1, Ermin, JN, Juxtanodin, KIAA1189

---

Product Information

66605-1-PBS targets ERMN in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27040

  Product name: Recombinant human ERMN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-257 aa of BC026345

  Sequence: MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSR

• Full Name: ermin, ERM-like protein
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC026345
• Gene Symbol: ERMN
• Gene ID (NCBI): 57471
• RRID: AB_2881965
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TAM6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ERMN is associated with cytoskeletal rearrangements and the stability of myelin sheath. A study has shown that ERMN is expressed specifically in oligodendrocytes in the central nervous system (CNS), and is involved in the formation of myelin (PMID: 20934411). The predicted MW of ERMN is 33 KDa, while western blot analyses of different tissue lysates using 66605-1-Ig antibody to ERMN detected a 50 kDa single band protein as a result of phosphorylation modification.