ERMP1 Polyclonal antibody

• 

  IHC staining of human spleen using 17321-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 17321-1-AP (ERMP1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 17321-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 17321-1-AP (ERMP1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 17321-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17321-1-AP (ERMP1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 17321-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17321-1-AP (ERMP1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 17321-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17321-1-AP (ERMP1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 17321-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17321-1-AP (ERMP1 Antibody) at dilution of 1:50 (under 40x lens).

ERMP1 Polyclonal Antibody for IHC, ELISA

Cat No. 17321-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF, ELISA

Synonyms

EC:3.4.-.-, FXNA, KIAA1815

---

Tested Applications

• Positive IHC detected in: human spleen tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

17321-1-AP targets ERMP1 in IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11297

  Product name: Recombinant human ERMP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 676-904 aa of BC031630

  Sequence: SNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVTSKGGDYFVFYSHGLQASAWQFWIEVQVSEEHPEGMVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTYDLFVF

• Full Name: endoplasmic reticulum metallopeptidase 1
• Calculated Molecular Weight: 317 aa, 36 kDa
• GenBank Accession Number: BC031630
• Gene Symbol: ERMP1
• Gene ID (NCBI): 79956
• RRID: AB_2878380
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z2K6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Acta Histochem; miR-9-5p attenuates ischemic stroke through targeting ERMP1-mediated endoplasmic reticulum stress.; Authors - Lumei Chi