ESCO1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ESCO1 Polyclonal antibody, PBS Only (29821-1-PBS)

• 

  WB analysis using 29821-1-AP (same clone as 29821-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29821-1-AP (ESCO1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29821-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29821-1-AP (same clone as 29821-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29821-1-AP (ESCO1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29821-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 29821-1-AP (same clone as 29821-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 29821-1-AP (ESCO1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29821-1-PBS in a different storage buffer formulation.

ESCO1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29821-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

CTF7 homolog 1, ECO1 homolog 1, EFO1, ESO1 homolog 1, hEFO1

---

Product Information

29821-1-PBS targets ESCO1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31189

  Product name: Recombinant human ESCO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of NM_052911

  Sequence: MMSIQEKSKENSSKVTKKSDDKNSETEIQDSQKNLAKKSGPKETIKSQAKSSSESKINQPELETRMSTRSSKAASNDKATKSINKNTVTVRGYSQESTKKKLSQKKLVHENPKANEQLNRRSQRLQQLTEVSRRSLRSREIQGQVQAVKQSLPPTKKEQCSSTQSKSNKTSQKHVKRKVLEVKSDSKEDENLVINEVINSPKGKKRKVEH

• Full Name: establishment of cohesion 1 homolog 1 (S. cerevisiae)
• Calculated Molecular Weight: 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: NM_052911
• Gene Symbol: ESCO1
• Gene ID (NCBI): 114799
• RRID: AB_3086174
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5FWF5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.