ESR2 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83447-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83447-1-PBS against Human ESR2 was performed. The affinity constant is 25.1 nM.

ESR2 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83447-1-PBS

Clone No.240412A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

ER BETA, Erb, ER-beta, ERβ, ESTRB

---

Product Information

83447-1-PBS targets ESR2 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5103

  Product name: Recombinant human ESR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC024181

  Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

• Full Name: estrogen receptor 2 (ER beta)
• Calculated Molecular Weight: 59 kDa
• GenBank Accession Number: BC024181
• Gene Symbol: ESR2
• Gene ID (NCBI): 2100
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92731
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.