ESR2 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse testis using 83447-3-RR (same clone as 83447-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 83447-3-RR (ESR2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83447-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 83447-3-RR (same clone as 83447-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 83447-3-RR (ESR2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83447-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83447-3-RR (same clone as 83447-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ESR2 antibody (83447-3-RR, Clone: 240412F2 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83447-3-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 83447-3-RR (same clone as 83447-3-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug Esr2 Recombinant Antibody (83447-3-RR, Clone:240412F2) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83447-3-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83447-3-RR (same clone as 83447-3-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Esr2 Recombinant Antibody (83447-3-RR, Clone:240412F2) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83447-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83447-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 83447-3-PBS against Human ESR2 was performed. The affinity constant is 16.6 pM.

• 

  Affinity and Kinetic Characterization of 83447-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83447-3-RR against Human ESR2 were performed. The affinity constant is 0.22 nM.

ESR2 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83447-3-PBS

Clone No.240412F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

240412F2, ER BETA, Erb, ER-beta, ERβ

---

Product Information

83447-3-PBS targets ESR2 in IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5103

  Product name: Recombinant human ESR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC024181

  Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

• Full Name: estrogen receptor 2 (ER beta)
• Calculated Molecular Weight: 59 kDa
• GenBank Accession Number: BC024181
• Gene Symbol: ESR2
• Gene ID (NCBI): 2100
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92731
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Estrogen receptor-beta (ESR2) is a member of the superfamily of nuclear receptors, which can transduce extracellular signals into transcriptional responses. It binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.