ESRP2 Polyclonal antibody

ESRP2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 23117-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

ESRP2, RBM35B, RNA binding motif protein 35B, RNA binding protein 35B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HeLa cells, HepG2 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23117-1-AP targets ESRP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19436

Product name: Recombinant human ESRP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 576-717 aa of BC030146

Sequence: TYTTFQATPTLIPTETAALYPSSALLPAARVPAAPTPVAYYPGPATQLYLNYTAYYPSPPVSPTTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL

Predict reactive species
Full Name epithelial splicing regulatory protein 2
Calculated Molecular Weight 727 aa, 78 kDa
Observed Molecular Weight 78 kDa
GenBank Accession NumberBC030146
Gene Symbol ESRP2
Gene ID (NCBI) 80004
RRIDAB_2879213
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H6T0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ESRP2 (Epithelial Splicing Regulatory Protein 2), also known as RBM35B(RNA binding motif protein 35B), is a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) family of RNA binding proteins. ESRP2 plays a role in the regulation of alternative splicing events of pre-mRNAs(PMID: 27401076). Overexpression of ESRP2 has been described in various malignant tumors, such as pancreatic ductal adenocarcinoma, oral squamous carcinoma, ovarian cancer, and luminal-type breast cancer(PMID: 33339518).

Protocols

Product Specific Protocols
IHC protocol for ESRP2 antibody 23117-1-APDownload protocol
WB protocol for ESRP2 antibody 23117-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human

Oncogene

Androgen receptor signaling regulates the transcriptome of prostate cancer cells by modulating global alternative splicing.

Authors - Kalpit Shah
Loading...
||
New chat Able
正在加载,请稍候...