ETV3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ETV3 Polyclonal antibody (11721-1-AP)

• 

  WB analysis using 11721-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11721-1-AP (ETV3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 11721-1-AP

  IP result of anti-ETV3 (IP:11721-1-AP, 4ug; Detection:11721-1-AP 1:500) with HepG2 cells lysate 1440 ug.

ETV3 Polyclonal Antibody for WB, IP, ELISA

Cat No. 11721-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

ets variant 3, ETV 3, PE-1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11721-1-AP targets ETV3 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2301

  Product name: Recombinant human ETV3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-143 aa of BC022868

  Sequence: MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGKIQTLLVGN

• Full Name: ets variant 3
• Calculated Molecular Weight: 512 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC022868
• Gene Symbol: ETV3
• Gene ID (NCBI): 2117
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41162
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ETV3 is a transcriptional repressor that belongs to the ETS family of transcription factors, which bind a common DNA sequence core motif (GGAA) via their ETS domains. ETV3 is preferentially expressed in mature DC including tissue-derived migratory DC (migDC) and facilitates their homeostatic maturation and CCR7-dependent migration. Phosphorylation of ETV3 regulated transcription by preventing its binding to DNA at promoters for several thousand genes, including some involved in negative feedback regulation of itself and of upstream signals (PMID: 36543959, 41678619). Western and IP analysis detected the specific band with an apparent MW of 57 kDa.