ETV5 Monoclonal antibody, PBS Only (Capture)

ETV5 Monoclonal Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 66657-1-PBS
Clone No.2A4A4

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, Sandwich ELISA, Indirect ELISA

ERM, Ets related protein ERM, ETS translocation variant 5, ets variant 5, ETV5

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66657-1-PBS targets ETV5 as part of a matched antibody pair:

MP50024-1: 66657-1-PBS capture and 66657-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3708

Product name: Recombinant human ETV5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 160-510 aa of BC007333

Sequence: SGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY

Predict reactive species
Full Name ets variant 5
Calculated Molecular Weight 510 aa, 58 kDa
Observed Molecular Weight 58-60 kDa
GenBank Accession NumberBC007333
Gene Symbol ETV5
Gene ID (NCBI) 2119
RRIDAB_2882014
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41161
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ETS variant gene 5(ETV5) belongs to the ETS oncogene family that shares a conserved peptide, ETS domain, which mediates sequence-specific DNA binding. ETV5 is a transcription factor and is required for spermatogonial stem cell self-renewal. ETV5 can be negatively regulated by COP1, a tumor suppressor. Also it has a role in branching morphogenesis in the developing kidney

Loading...
||
New chat Able
正在加载,请稍候...