EVA1B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EVA1B Polyclonal antibody, PBS Only (20793-1-PBS)

• 

  WB analysis using 20793-1-AP (same clone as 20793-1-PBS)

  human placenta tissue was subjected to SDS PAGE followed by western blot with 20793-1-AP (EVA1B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20793-1-PBS in a different storage buffer formulation.

EVA1B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20793-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C1orf78

---

Product Information

20793-1-PBS targets EVA1B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14578

  Product name: Recombinant human FAM176B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC006241

  Sequence: MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVF

• Full Name: family with sequence similarity 176, member B
• Calculated Molecular Weight: 165 aa, 18 kDa
• Observed Molecular Weight: 25-26 kDa
• GenBank Accession Number: BC006241
• Gene Symbol: FAM176B
• Gene ID (NCBI): 55194
• RRID: AB_3669348
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVM1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EVA1B, also known as FAM176B or C1orf78, is a single-pass membrane protein that belongs to the FAM176 family. EVA1B is an important paralog of the EVA1A and is associated with the tumor immune microenvironment and clinical prognosis