EVI2A Polyclonal antibody

• 

  WB analysis of human brain using 17415-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17415-1-AP (EVI2A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 17415-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17415-1-AP (EVI2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 17415-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17415-1-AP (EVI2A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 17415-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17415-1-AP (EVI2A antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 17415-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EVI2A antibody (17415-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

EVI2A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17415-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EVI-2A, EVI2, EVI 2A, EVDA

---

Tested Applications

• Positive WB detected in: human brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

17415-1-AP targets EVI2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11075

  Product name: Recombinant human EVI2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-236 aa of BC035572

  Sequence: MPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG

• Full Name: ecotropic viral integration site 2A
• Calculated Molecular Weight: 236 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC035572
• Gene Symbol: EVI2A
• Gene ID (NCBI): 2123
• RRID: AB_2101143
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22794
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell Proteomics; A combined omics approach to generate the surface atlas of human naive CD4+ T cells during early TCR activation.; Authors - Anke Graessel
human	WB	Oncol Res; Integrative bioinformatics and in vitro exploration of EVI2A expression: unraveling its immunological and prognostic implications in kidney renal clear cell carcinoma; Authors - Rong Liu