EVI5 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse stomach using 84738-2-RR (same clone as 84738-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 84738-2-RR (EVI5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84738-2-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 84738-2-RR (same clone as 84738-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using EVI5 antibody (84738-2-RR, Clone: 241918D11 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84738-2-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 84738-2-RR (same clone as 84738-2-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug EVI5 Recombinant antibody (84738-2-RR, Clone:241918D11) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 84738-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84738-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84738-2-RR against Human EVI5 were performed. The affinity constant is 1.11 nM.

EVI5 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84738-2-PBS

Clone No.241918D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

241918D11, NB4S

---

Product Information

84738-2-PBS targets EVI5 in IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26739

  Product name: Recombinant human EVI5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC156793

  Sequence: MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSP

• Full Name: ecotropic viral integration site 5
• Calculated Molecular Weight: 810 aa, 93 kDa
• GenBank Accession Number: BC156793
• Gene Symbol: EVI5
• Gene ID (NCBI): 7813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O60447
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EVI5 functions as a regulator of cell cycle progression by stabilizing the FBXO5 protein and promoting cyclin-A accumulation during interphase. It may play a role in cytokinesis (PMID: 16439210).