Exo70 Polyclonal antibody

• 

  WB analysis of human brain using 12014-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12014-1-AP (Exo70 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12014-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12014-1-AP (Exo70 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12014-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12014-1-AP (Exo70 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12014-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12014-1-AP (Exo70 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 12014-1-AP

  IP result of anti-Exo70 (IP:12014-1-AP, 3ug; Detection:12014-1-AP 1:600) with mouse brain tissue lysate 2640ug.

• 

  IHC staining of human gliomas using 12014-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 12014-1-AP (Exo70 antibody) at dilution of 1:50 (under 10x lens).

Exo70 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12014-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

2 5 3p, EX070, Exo70, Exo70p, EXOC1, EXOC7, exocyst complex component 7, KIAA1067, YJL085W

---

Tested Applications

• Positive WB detected in: human brain tissue, HEK-293 cells, mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IF: See 5 publications below
• CoIP: See 2 publications below

Product Information

12014-1-AP targets Exo70 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2628

  Product name: Recombinant human EXOC7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-354 aa of BC011045

  Sequence: MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENLQRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVKLLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVIRISRWLVEYGRNQDFMNVYYQIRSSQLDRSIKGLKEHFHKSSSSSGVPYSPAIPNKRKDTPTKKPVKRPGTIRKAQNLLKQYSQHGLDGKKGGSNLIPLEGRDDMLDVETDAYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDG

• Full Name: exocyst complex component 7
• Calculated Molecular Weight: 735 aa, 83 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC011045
• Gene Symbol: Exo70
• Gene ID (NCBI): 23265
• RRID: AB_2101698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPT5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Blood; vWF maturation and release are controlled by two regulators of Weibel-Palade body biogenesis: exocyst and BLOC-2.; Authors - Anish Vaibhav Sharda
mouse	WB	Elife; Functional hierarchy among different Rab27 effectors involved in secretory granule exocytosis; Authors - Kunli Zhao
rat	IF	Mol Neurobiol; The Exocyst Component Exo70 Modulates Dendrite Arbor Formation, Synapse Density, and Spine Maturation in Primary Hippocampal Neurons.; Authors - Matías Lira
human	WB,IF	Placenta; Exocyst complex protein expression in the human placenta.; Authors - I M Gonzalez
mouse	WB,IF,CoIP	Biol Res; Exo70 intracellular redistribution after repeated mild traumatic brain injury.; Authors - Matías Lira
human,rat	IF,CoIP	Life Sci Alliance; An isoform-specific function of Cdc42 in regulating mammalian Exo70 during axon formation; Authors - Priyadarshini Ravindran