EXTL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EXTL2 Polyclonal antibody, PBS Only (12828-1-PBS)

• 

  WB analysis using 12828-1-AP (same clone as 12828-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12828-1-AP (EXTL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12828-1-AP (same clone as 12828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12828-1-AP (EXTL2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12828-1-AP (same clone as 12828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12828-1-AP (EXTL2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 12828-1-AP (same clone as 12828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12828-1-AP (EXTL2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 12828-1-AP (same clone as 12828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12828-1-AP (EXTL2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12828-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 12828-1-AP (same clone as 12828-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using EXTL2 antibody (12828-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 12828-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12828-1-AP (same clone as 12828-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using EXTL2 antibody (12828-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12828-1-PBS in a different storage buffer formulation.

EXTL2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12828-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Alpha GalNAcT EXTL2, Alpha-1,4-N-acetylhexosaminyltransferase EXTL2, Alpha-GalNAcT EXTL2, EC:2.4.1.223, exostoses (multiple) like 2

---

Product Information

12828-1-PBS targets EXTL2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3548

  Product name: Recombinant human EXTL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-330 aa of BC036015

  Sequence: LPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNITISQFGFPYANYKRKI

• Full Name: exostoses (multiple)-like 2
• Calculated Molecular Weight: 330 aa, 37 kDa
• Observed Molecular Weight: 37-43 kDa
• GenBank Accession Number: BC036015
• Gene Symbol: EXTL2
• Gene ID (NCBI): 2135
• RRID: AB_2102130
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBQ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Exostosin-like 2 (EXTL2) is one of three EXT-like genes in the human genome that are homologous to EXT1 and EXT2, encodes a transferase that adds not only GlcNAc but also N-acetylgalactosamine to the glycosaminoglycan (GAG)-protein linkage region via an α1,4-linkage. Loss of the enzyme EXTL2, a regulatory mechanism serving to limit CSPG synthesis, resulted in more extensive versican deposition into a lysolecithin-induced demyelinated injury, a larger area of myelin disruption with an associated decrease in axonal density within the lesion, and greater accumulation of macrophages and microglia (PMID: 32703234, 23395820)