EYA2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• EYA2 Recombinant monoclonal antibody, PBS Only (86046-2-PBS)

EYA2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86046-2-PBS

Clone No.250437D7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EAB1, EC:3.1.3.48

• 

  WB analysis of Y79 using 86046-2-RR (same clone as 86046-2-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 86046-2-RR (EYA2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86046-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of IMR-32 using 86046-2-RR (same clone as 86046-2-PBS)

  IMR-32 cells were subjected to SDS PAGE followed by western blot with 86046-2-RR (EYA2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86046-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86046-2-PBS targets EYA2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29403

  Product name: Recombinant human EYA2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 241-583 aa of BC013882

  Sequence: LSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL

• Full Name: eyes absent homolog 2 (Drosophila)
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC013882
• Gene Symbol: EYA2
• Gene ID (NCBI): 2139
• RRID: AB_3744576
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00167
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EYA2, also named EAB1, belongs to the HAD-like hydrolase superfamily and EYA family. It coactivates SIX1. The Six1-EYA2 interaction may inhibit breast cancer progression. EYA2 is required for Six1-activated TGF-beta signaling.(PMID:21706047) It may be involved in the development of the eye. This protein has 3 isoforms produced by alternative splicing with the molecular weight of 59 kDa, 57 kDa, and 50 kDa. This recombinant antibody can not detect the modified isform with the molecular weight of 70 kda, compared with 11314-1-AP.