EYA3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EYA3 Polyclonal antibody (21196-1-AP)

• Featured Product
• KD/KO Validated

EYA3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21196-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:3.1.3.48

• 

  WB analysis of HeLa using 21196-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21196-1-AP (EYA3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 21196-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 21196-1-AP (EYA3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 21196-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21196-1-AP (EYA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 21196-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 21196-1-AP (EYA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of L02 using 21196-1-AP

  IP result of anti-EYA3 (IP:21196-1-AP, 4ug; Detection:21196-1-AP 1:1000) with L02 cells lysate 1800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 21196-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21196-1-AP (EYA3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 21196-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21196-1-AP (EYA3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 21196-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21196-1-AP (EYA3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 21196-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21196-1-AP (EYA3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 21196-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using EYA3 antibody (21196-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of A431 using 21196-1-AP

  1x10^6 A431 cells were intracellularly stained with 0.25 ug EYA3 Polyclonal antibody (21196-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EYA3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, L02 cells
• Positive IP detected in: L02 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21196-1-AP targets EYA3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15544

  Product name: Recombinant human EYA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC029500

  Sequence: MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQMYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDS

• Full Name: eyes absent homolog 3 (Drosophila)
• Calculated Molecular Weight: 573 aa, 63 kDa
• Observed Molecular Weight: 63-66 kDa
• GenBank Accession Number: BC029500
• Gene Symbol: EYA3
• Gene ID (NCBI): 2140
• RRID: AB_10732957
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99504
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EYA3(Eyes absent homolog 3) belongs to the HAD-like hydrolase superfamily.Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis.EYA3, like EYA1, is expressed in the ninth week of human development and may also underlie developmental defects(PMID:9020840).It has 2 isoforms produced by alternative splicing.This antibody is specific to EYA3.

Publications

What published studies show

The EYA3 antibody (Cat# 21196-1-AP) has 10 total citations. Publications appear in Nature Communications, Cell Reports, Journal of Investigative Dermatology, Molecular Therapy Nucleic Acids, International Journal of Molecular Sciences, Scientific Reports, Journal of Biological Chemistry, Annals of Translational Medicine, and PLoS ONE. Research fields span pulmonary arterial hypertension, acute myeloid leukemia, Merkel cell carcinoma, gastric cancer, endothelial biology, actin cytoskeleton regulation, protein phosphorylation, and anti-angiogenic drug development.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Nat Commun; The EYA3 tyrosine phosphatase activity promotes pulmonary vascular remodeling in pulmonary arterial hypertension.; Authors - Yuhua Wang
		Cell Rep; Retinal determination network reactivation drives chemoresistance and blocks myeloid differentiation in acute myeloid leukemia.; Authors - Liam Clayfield
human	WB	J Invest Dermatol; Merkel Cell Carcinoma Sensitivity to EZH2 Inhibition Is Mediated by SIX1 Derepression; Authors - Ashley K Gartin
human	WB	Mol Ther Nucleic Acids; miR-342-5p downstream to Notch enhances arterialization of endothelial cells in response to shear stress by repressing MYC; Authors - Xiaoyan Zhang
human	WB,IP	Int J Mol Sci; Analysis of EYA3 Phosphorylation by Src Kinase Identifies Residues Involved in Cell Proliferation.; Authors - Aura E Ionescu
		Sci Rep; WDR1 is a novel EYA3 substrate and its dephosphorylation induces modifications of the cellular actin cytoskeleton.; Authors - Mihaela Mentel