EGFR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EGFR Polyclonal antibody (30847-1-AP)

EGFR Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30847-1-AP Copied!

Publications (19)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:2.7.10.1, EGF R, Erbb, erbb 1, Erbb1

• 

  WB analysis using 30847-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30847-1-AP (Egfr antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse placenta using 30847-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 30847-1-AP (EGFR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 30847-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using Egfr antibody (30847-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EGFR in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse liver tissue
• Positive IHC detected in: mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30847-1-AP targets EGFR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33621

  Product name: Recombinant mouse Egfr protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 988-1210 aa of NM_207655

  Sequence: RMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTEDNIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLNTAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRVAPPSSEFIGA*

• Full Name: epidermal growth factor receptor
• Calculated Molecular Weight: 135 kDa
• Observed Molecular Weight: 140-180 kDa
• GenBank Accession Number: NM_207655
• Gene Symbol: Egfr
• Gene ID (NCBI): 13649
• RRID: AB_3086421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q01279
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The epidermal growth factor receptor (EGFR) is a member of the ErbB family of receptor tyrosine kinases (RTKs). Binding of EGFR to epidermal growth factor family ligands triggers a signaling cascade through allosteric activation of epidermal growth factor receptor kinase and trans-autophosphorylation of key tyrosine residues in the tail of the cytoplasmic receptor (PMID: 24691965). Due to phosphorylation, the apparent molecular weight is higher than the calculated molecular weight of 140 kDa. EFGR has been implicated in learning and memory enhancement and pain signaling in mammals (PMID: 20639532 and 35131940).

Publications

What published studies show

The EGFR Polyclonal antibody (Cat# 30847-1-AP) has 19 citations across journals including Biomaterials, Cell Mol Life Sci, Sci Rep, EMBO J, Int J Mol Sci, PLoS One, and Nanomedicine. Research fields span oncology (lung, breast, oral, renal cancers), cardiovascular disease (fibrosis, ischemia, heart failure), pulmonary disorders (asthma, acute lung injury), liver disease, inflammatory bowel disease, stroke, wound healing, and tumor immunotherapy. Applications are predominantly Western blot and immunohistochemistry in human, mouse, and rat models.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biomaterials; Engineered bacterial outer membrane vesicles enhanced tumor immunotherapy through remodeling tumor stroma and targeted delivery of CD73 siRNA.; Authors - Lili Cheng
human	WB	Cell Prolif; Ellagic Acid-Loaded sEVs Encapsulated in GelMA Hydrogel Accelerate Diabetic Wound Healing by Activating EGFR on Skin Repair Cells; Authors - Lige Tian
human,mouse,rat	WB	Ecotoxicol Environ Saf; DEHP exposure and cardiac fibrosis risk: An integrated network toxicology and molecular experimental investigation.; Authors - Qinyao Zhang
mouse	IF	Cell Mol Life Sci; Sorcin regulates alveolarization and airway tissue remodeling during lung morphogenesis.; Authors - Claudia Tito
mouse	WB	Int Immunopharmacol; Network pharmacology analysis and experimental validation of EGCG's therapeutic effects against acute lung injury in sepsis.; Authors - Xianwei Jin
		Int J Mol Sci; Dual Disruption of EGFR/PI3K Signaling: IGF2BP2 Targeting Reverses Anti-EGFR Resistance in CAFs-Infiltrated Oral Squamous Cell Carcinoma; Authors - Yaying Hu