EGFR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EGFR Polyclonal antibody (30847-1-AP)

EGFR Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30847-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:2.7.10.1, EGF R, Erbb, erbb 1, Erbb1

• 

  WB analysis using 30847-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30847-1-AP (Egfr antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse placenta using 30847-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 30847-1-AP (EGFR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 30847-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using Egfr antibody (30847-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

---

Tested Applications

• Positive WB detected in: A549 cells, mouse liver tissue
• Positive IHC detected in: mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

30847-1-AP targets EGFR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33621

  Product name: Recombinant mouse Egfr protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 988-1210 aa of NM_207655

  Sequence: RMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTEDNIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLNTAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRVAPPSSEFIGA*

• Full Name: epidermal growth factor receptor
• Calculated Molecular Weight: 135 kDa
• Observed Molecular Weight: 140-180 kDa
• GenBank Accession Number: NM_207655
• Gene Symbol: Egfr
• Gene ID (NCBI): 13649
• RRID: AB_3086421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q01279
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The epidermal growth factor receptor (EGFR) is a member of the ErbB family of receptor tyrosine kinases (RTKs). Binding of EGFR to epidermal growth factor family ligands triggers a signaling cascade through allosteric activation of epidermal growth factor receptor kinase and trans-autophosphorylation of key tyrosine residues in the tail of the cytoplasmic receptor (PMID: 24691965). Due to phosphorylation, the apparent molecular weight is higher than the calculated molecular weight of 140 kDa. EFGR has been implicated in learning and memory enhancement and pain signaling in mammals (PMID: 20639532 and 35131940).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Chem Biodivers; UPLC-MS/MS-Network Pharmacology and Experimental Validation Reveal Active Components of Ficus tikoua for Ameliorating Liver Fibrosis.; Authors - Shi-Ying Xu
		Curr Issues Mol Biol; An Integrated Network Pharmacology, Molecular Docking, Molecular Dynamics Simulation, and Experimental Validation Study to Investigate the Potential Mechanism of Isoliquiritigenin in the Treatment of Ischemic Stroke; Authors - Hang Yuan
		Int J Mol Sci; Dual Disruption of EGFR/PI3K Signaling: IGF2BP2 Targeting Reverses Anti-EGFR Resistance in CAFs-Infiltrated Oral Squamous Cell Carcinoma; Authors - Yaying Hu
human	WB	Naunyn Schmiedebergs Arch Pharmacol; Citronellol potentiates sunitinib efficacy in renal cell carcinoma by targeting JAK2/STAT3 signaling pathway.; Authors - Zongrun Sun
human	WB	Cell Prolif; Ellagic Acid-Loaded sEVs Encapsulated in GelMA Hydrogel Accelerate Diabetic Wound Healing by Activating EGFR on Skin Repair Cells; Authors - Lige Tian
human	WB	Sci Rep; The E3 ubiquitin ligase RNF180 modulates the EGFR/PI3K/AKT pathway to reduce cisplatin resistance in non-small cell lung cancer.; Authors - Xiaoyan Song