Anti-Mouse Endoglin/CD105 Rabbit Recombinant Antibody

• 

  FC experiment of bEnd.3 using 98290-1-RR

  1x10^6 bEnd.3 cells were surface stained with 0.25 ug Anti-Mouse Endoglin/CD105 Rabbit RecAb (98290-1-RR, Clone: 242305E7) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98290-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98290-1-RR against Mouse Endoglin/CD105 were performed. The affinity constant is 0.523 nM.

Endoglin/CD105 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98290-1-RR

Clone No.242305E7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD105, 242305E7, Edg, endoglin, Eng

---

Tested Applications

• Positive FC detected in: bEnd.3 cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98290-1-RR targets Endoglin/CD105 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1292

  Product name: Recombinant Mouse Endoglin/CD105 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 27-580 aa of NM_007932.2

  Sequence: ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGK

• Full Name: endoglin
• Calculated Molecular Weight: 70 kDa
• GenBank Accession Number: NM_007932.2
• Gene Symbol: CD105
• Gene ID (NCBI): 13805
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q63961
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Endoglin (ENG, CD105) is a homodimeric cell membrane glycoprotein of 180 kDa, composed of disulphide-linked subunits of 90-95 kDa. Endoglin is a proliferation-associated and hypoxia-inducible protein mainly expressed on vascular endothelial cells. It acts as an accessory receptor for transforming growth factor beta (TFG-β) and is involved in vascular development and remodelling. The important role of Endoglin in angiogenesis and in tumor progression makes it an ideal target for antiangiogenic therapy and a good marker for tumor prognosis. (PMID: 1326540; 14528280; 21737653; 12773481)