Product Information
25113-1-PBS targets Epigen in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18899 Product name: Recombinant human EPGN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-94 aa of BC127938 Sequence: AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGER Predict reactive species |
| Full Name | epithelial mitogen homolog (mouse) |
| Calculated Molecular Weight | 154 aa, 17 kDa |
| GenBank Accession Number | BC127938 |
| Gene Symbol | Epigen |
| Gene ID (NCBI) | 255324 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6UW88 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
