Able AI
What's the best dilution for Ezrin in ?
Product Information
85790-1-PBS targets Ezrin in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag23530 Product name: Recombinant human Ezrin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 477-529 aa of BC013903 Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR Predict reactive species |
| Full Name | ezrin |
| Calculated Molecular Weight | 69 kDa |
| GenBank Accession Number | BC013903 |
| Gene Symbol | Ezrin |
| Gene ID (NCBI) | 7430 |
| ENSEMBL Gene ID | ENSG00000092820 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P15311 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
