F2R Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP02430-1

  Sandwich ELISA standard curve of MP02430-1, Human PAR1/Thrombin Receptor Recombinant Matched Antibody Pair - PBS only. 86179-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag24378. 86179-2-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL

• 

  Sample test of MP02430-1

  The mean PAR1/Thrombin Receptor concentration was determined to be 24.63 ng/mL in HT-29 cell extract based on a 1.5 mg/mL extract load.

• 

  Sample test of MP02430-1

  Serum of sixteen individual healthy human donors was measured. The human PAR1/Thrombin Receptor concentration of detected samples was determined to be 1.53 ng/mL with a range of 0.09 - 6.29 ng/mL.

F2R Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 86179-3-PBS

Clone No.250720B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

PAR1, Thrombin receptor, CF2R, HTR, PAR-1

---

Product Information

86179-3-PBS targets F2R as part of a matched antibody pair:

MP02430-1: 86179-3-PBS capture and 86179-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24378

  Product name: Recombinant human F2R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-102 aa of BC051909

  Sequence: LLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT

• Full Name: coagulation factor II (thrombin) receptor
• Calculated Molecular Weight: 47 kDa
• GenBank Accession Number: BC051909
• Gene Symbol: F2R
• Gene ID (NCBI): 2149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P25116
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.