PAR2 Recombinant monoclonal antibody, PBS Only

• 

PAR2 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84006-3-PBS

Clone No.241116F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Coagulation factor II receptor-like 1, F2RL1, G protein coupled receptor 11, GPR11, G-protein coupled receptor 11

---

Product Information

84006-3-PBS targets PAR2 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2801

  Product name: Recombinant human F2RL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-87 aa of BC018130

  Sequence: LLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFV

• Full Name: coagulation factor II (thrombin) receptor-like 1
• Calculated Molecular Weight: 397 aa, 44 kDa
• GenBank Accession Number: BC018130
• Gene Symbol: PAR2
• Gene ID (NCBI): 2150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55085
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.