F8A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• F8A2 Polyclonal antibody (32696-1-AP)

• 

  WB analysis using 32696-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32696-1-AP (F8A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32696-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32696-1-AP (F8A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 32696-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using F8A2 antibody (32696-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

F8A2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32696-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

40-kDa huntingtin-associated protein, Coagulation Factor VIII Associated 2, CpG island protein, F8A1, F8A3

---

Tested Applications

• Positive WB detected in: OVCAR-3 cells, SKOV-3 cells, mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32696-1-AP targets F8A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38529

  Product name: Recombinant human F8A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-216 aa of NM_012151.3

  Sequence: GDFLARYRLVSNKLKKRFLRKPNVAEAGEQFGQLGRELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAAYGEPLQAAASALGAAVRLHLELGQPAAAAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRLAREHGS

• Full Name: coagulation factor VIII-associated (intronic transcript) 2
• Calculated Molecular Weight: 39kDa，371aa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: NM_012151.3
• Gene Symbol: F8A2
• Gene ID (NCBI): 474383
• RRID: AB_3742713
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P23610
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

F8A2 (Coagulation Factor VIII Associated 2) is a protein associated with coagulation factor VIII, which is widely expressed in a variety of cell types, localized mainly in the cytoplasm and nucleus, and also co-localized with Huntington's protein (HTT). Although its specific function is not fully defined, F8A2 may play an important role in intracellular and vesicular transport. In addition, F8A2 co-localizes with ubiquitin in neuronal cells and may be involved in the pathological process of neurodegenerative diseases.