FA2H Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FA2H Polyclonal antibody (15452-1-AP)

FA2H Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15452-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FAXDC1, Fatty acid hydroxylase domain-containing protein 1, Fatty acid alpha-hydroxylase, Fatty acid 2-hydroxylase, FAAH

• 

  WB analysis using 15452-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15452-1-AP (FA2H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human stomach using 15452-1-AP

  human stomach tissue were subjected to SDS PAGE followed by western blot with 15452-1-AP (FA2H antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse colon using 15452-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 15452-1-AP (FA2H antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 15452-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15452-1-AP (FA2H antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15452-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 15452-1-AP (FA2H antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FA2H in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, human brain tissue, human stomach tissue, mouse colon tissue, MKN-45 cells, SGC-7901 cells, mouse brain tissue
• Positive IHC detected in: mouse brain tissue, human colon cancer tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15452-1-AP targets FA2H in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7717

  Product name: Recombinant human FA2H protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC002679

  Sequence: MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGL

• Full Name: fatty acid 2-hydroxylase
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 38-43 kDa
• GenBank Accession Number: BC002679
• Gene Symbol: FA2H
• Gene ID (NCBI): 79152
• RRID: AB_2101886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L5A8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FA2H(Fatty acid 2-hydroxylase) required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. The deduced 372-amino acid protein has a calculated molecular mass of 42.8 kD .Both mouse and human FA2H have a C-terminal endoplasmic reticulum (ER) retention motif(PMID: 15658937).

Publications

What published studies show

FA2H (Fatty Acid 2-Hydroxylase) antibody (Cat# 15452-1-AP) has 11 total citations across journals including Signal Transduction and Targeted Therapy, Cancer Cell, Gut, Developmental Cell, Current Biology, Journal of Medicinal Chemistry, Journal of Neurochemistry, Frontiers in Oncology, Biochemical and Biophysical Research Communications, Journal of Biochemistry, and Journal of Toxicological Sciences. Research fields span cancer metastasis, glioblastoma, pancreatic cancer, breast cancer, sphingolipid metabolism, and CNS lipid regulation.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Signal Transduct Target Ther; Dysregulated ceramides metabolism by fatty acid 2-hydroxylase exposes a metabolic vulnerability to target cancer metastasis; Authors - Xuantong Zhou
human	IF	Cancer Cell; Cell Lineage-Based Stratification for Glioblastoma.; Authors - Zilai Wang
mouse	WB	Gut; Long-chain sulfatide enrichment is an actionable metabolic vulnerability in intraductal papillary mucinous neoplasm (IPMN)-associated pancreatic cancers; Authors - Yihui Chen
		Dev Cell; Quiescent human glioblastoma cancer stem cells drive tumor initiation, expansion, and recurrence following chemotherapy.; Authors - Xuanhua P Xie
	WB	Curr Biol; FA2H controls cool temperature sensing through modifying membrane sphingolipids in Drosophila; Authors - Qiaoran Li
human	WB	J Med Chem; Substrate-based fragment identification for the development of selective, nonpeptidic inhibitors of striatal-enriched protein tyrosine phosphatase.; Authors - Tyler D Baguley