FA2H Polyclonal antibody

• 

  WB analysis using 15452-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15452-1-AP (FA2H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 15452-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15452-1-AP (FA2H antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human stomach using 15452-1-AP

  human stomach tissue were subjected to SDS PAGE followed by western blot with 15452-1-AP (FA2H antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 15452-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 15452-1-AP (FA2H antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15452-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15452-1-AP (FA2H antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 15452-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 15452-1-AP (FA2H antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

FA2H Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15452-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FAXDC1, Fatty acid hydroxylase domain-containing protein 1, Fatty acid alpha-hydroxylase, Fatty acid 2-hydroxylase, FAAH

---

Tested Applications

• Positive WB detected in: HeLa cells, human brain tissue, human stomach tissue, mouse colon tissue, MKN-45 cells, SGC-7901 cells, mouse brain tissue
• Positive IHC detected in: mouse brain tissue, human colon cancer tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 7 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

15452-1-AP targets FA2H in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7717

  Product name: Recombinant human FA2H protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC002679

  Sequence: MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGL

• Full Name: fatty acid 2-hydroxylase
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 38-43 kDa
• GenBank Accession Number: BC002679
• Gene Symbol: FA2H
• Gene ID (NCBI): 79152
• RRID: AB_2101886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L5A8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FA2H(Fatty acid 2-hydroxylase) required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. The deduced 372-amino acid protein has a calculated molecular mass of 42.8 kD .Both mouse and human FA2H have a C-terminal endoplasmic reticulum (ER) retention motif(PMID: 15658937).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cancer Cell; Cell Lineage-Based Stratification for Glioblastoma.; Authors - Zilai Wang
mouse	WB	Gut; Long-chain sulfatide enrichment is an actionable metabolic vulnerability in intraductal papillary mucinous neoplasm (IPMN)-associated pancreatic cancers; Authors - Yihui Chen
		Dev Cell; Quiescent human glioblastoma cancer stem cells drive tumor initiation, expansion, and recurrence following chemotherapy.; Authors - Xuanhua P Xie
	WB	Curr Biol; FA2H controls cool temperature sensing through modifying membrane sphingolipids in Drosophila; Authors - Qiaoran Li
human	WB,IHC	Front Oncol; FA2H Exhibits Tumor Suppressive Roles on Breast Cancers via Cancer Stemness Control.; Authors - Xiaofeng Dai
human	WB	J Med Chem; Substrate-based fragment identification for the development of selective, nonpeptidic inhibitors of striatal-enriched protein tyrosine phosphatase.; Authors - Tyler D Baguley