Use Able AI chat for product recommendations

FABP1 Monoclonal antibody

FABP1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 68227-1-Ig
Clone No.1B6C8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), ELISA

liver FABP, 1B6C8, FABPL, Fatty acid binding protein 1, Fatty acid-binding protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat liver tissue, pig liver tissue, mouse liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue, mouse brain tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68227-1-Ig targets FABP1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32836

Product name: Recombinant human FABP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-127 aa of BC032801

Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Predict reactive species
Full Name fatty acid binding protein 1, liver
Calculated Molecular Weight 127 aa, 14 kDa
Observed Molecular Weight 14 kDa
GenBank Accession NumberBC032801
Gene Symbol FABP1
Gene ID (NCBI) 2168
RRIDAB_2935315
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP07148
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 was elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446).

Protocols

Product Specific Protocols
FC protocol for FABP1 antibody 68227-1-IgDownload protocol
IF protocol for FABP1 antibody 68227-1-IgDownload protocol
IHC protocol for FABP1 antibody 68227-1-IgDownload protocol
WB protocol for FABP1 antibody 68227-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Adv Sci (Weinh)

Single-Cell Transcriptomic Analysis of Tumor Heterogeneity and the Microenvironment in Pseudomyxoma Peritonei.

Authors - Xi Li

Commun Biol

Spatially and temporally comparative proteomics provide insights into dynamic response patterns to PEDV infection.

Authors - Wenjiao Jin
Loading...
||
New chat

Able

正在加载,请稍候...