CoraLite® Plus 488-conjugated FABP1 Monoclonal antibody

FABP1 Monoclonal Antibody for IF-P
Cat No. CL488-68227
Clone No.1B6C8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF-P

liver FABP, 1B6C8, FABPL, Fatty acid binding protein 1, Fatty acid-binding protein 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse small intestine tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68227 targets FABP1 in IF-P applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32836

Product name: Recombinant human FABP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-127 aa of BC032801

Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Predict reactive species
Full Name fatty acid binding protein 1, liver
Calculated Molecular Weight 127 aa, 14 kDa
Observed Molecular Weight 14 kDa
GenBank Accession NumberBC032801
Gene Symbol FABP1
Gene ID (NCBI) 2168
RRIDAB_3084448
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP07148
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 was elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 FABP1 antibody CL488-68227Download protocol
IF protocol for CL Plus 488 FABP1 antibody CL488-68227Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...