FABP1 Monoclonal antibody, PBS Only

FABP1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA
Cat No. 68227-1-PBS
Clone No.1B6C8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

liver FABP, 1B6C8, FABPL, Fatty acid binding protein 1, Fatty acid-binding protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68227-1-PBS targets FABP1 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32836

Product name: Recombinant human FABP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-127 aa of BC032801

Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Predict reactive species
Full Name fatty acid binding protein 1, liver
Calculated Molecular Weight 127 aa, 14 kDa
Observed Molecular Weight 14 kDa
GenBank Accession NumberBC032801
Gene Symbol FABP1
Gene ID (NCBI) 2168
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP07148
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 was elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446).

Loading...
||
New chat Able
正在加载,请稍候...