FABP3 Monoclonal antibody

• 

  WB analysis using 60280-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60280-1-Ig (FABP3 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 60280-1-Ig

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 60280-1-Ig (FABP3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 60280-1-Ig

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 60280-1-Ig (FABP3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 60280-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using FABP3 antibody (60280-1-Ig, Clone: 2B5C1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of mouse heart using 60280-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using FABP3 antibody (60280-1-Ig, Clone: 2B5C1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of mouse heart using 60280-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using FABP3 antibody (60280-1-Ig, Clone: 2B5C1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

FABP3 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60280-1-Ig

Clone No.2B5C1

Publications(4)

Reviews (1)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

FABP11, FABP3, Fatty acid binding protein 3, H FABP, M FABP, MDGI, O FABP

---

Tested Applications

• Positive WB detected in: human heart tissue, rat heart, mouse heart
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1900-1:7600
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

60280-1-Ig targets FABP3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21483

  Product name: Recombinant human FABP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-133 aa of BC007021

  Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

• Full Name: fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC007021
• Gene Symbol: FABP3
• Gene ID (NCBI): 2170
• RRID: AB_2881398
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05413
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FABP3 (fatty-acid-binding protein 3), also known as heart-type FABP or mammary-derived growth inhibitor (MDGI), is a small 15-kDa cytoplasmic protein transporting fatty acids and other lipophilic substances from the cytoplasm to the nucleus. It is most ubiquitously expressed in heart and skeletal muscle.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	J Cell Mol Med; Four transcription profile-based models identify novel prognostic signatures in oesophageal cancer.; Authors - Tongyan Liu
human	WB	Mol Cell Proteomics; Quantitative ubiquitylome analysis reveals specificity of RNF111/Arkadia E3 ubiquitin ligase for its degradative substrates SKI and SKIL/SnoN in TGF-β signaling pathway; Authors - Victor Laigle
human	WB	Front Oncol; Multi-Omics Analysis of Fatty Acid Metabolism in Thyroid Carcinoma.; Authors - Jinghui Lu
mouse	WB	Mol Med; Calpain inhibition as a novel therapeutic strategy for aortic dissection with acute lower extremity ischemia; Authors - Qiwen Tan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Marco (Verified Customer) (07-04-2024)

We are very happy with the results of this antibody

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: NRVCMs