FABP5 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 82551-2-RR (same clone as 82551-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82551-2-RR (FABP5 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82551-2-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02674-1

  Plasma of five individual healthy human donors was measured. The FABP5 concentration of detected samples was determined to be 3.48 ng/mL with a range of 2.03-6.43 ng/mL.

• 

  Sandwich ELISA sample test of MP02674-1

  Urine of six individual healthy human donors was measured. The FABP5 concentration of detected samples was determined to be 16.17 ng/mL with a range of 1.14-77.03 ng/mL.

• 

  Sandwich ELISA standard curve of MP02674-1

  Sandwich ELISA standard curve of MP02674-1, Human FABP5 Recombinant Matched Antibody Pair - PBS only. 82551-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag3005. 82551-2-PBS was HRP conjugated as the detection antibody. Range: 0.625-40 ng/mL.

FABP5 Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 82551-2-PBS

Clone No.243154G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

EFABP, Epidermal-type fatty acid-binding protein, Fatty acid binding protein 5, Fatty acid-binding protein 5, Fatty acid-binding protein, epidermal

---

Product Information

82551-2-PBS targets FABP5 as part of a matched antibody pair:

MP02674-1: 82551-3-PBS capture and 82551-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3005

  Product name: Recombinant human FABP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC019385

  Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

• Full Name: fatty acid binding protein 5 (psoriasis-associated)
• Calculated Molecular Weight: 135 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC019385
• Gene Symbol: FABP5
• Gene ID (NCBI): 2171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q01469
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FABP5, also named as PA-FABP and E-FABP, belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It is high specificity for fatty acids. FABP5 is highest affinity for C18 chain length. It may be involved in keratinocyte differentiation. FABP5 is a fatty acid-binding protein and is expressed in epidermis and endothelial cells of the microvasculature of different organs. FABP5 has also been identified as a tumor-associated antigen, which is highly expressed in various cancers. FABP5 was detected in the sera of HNSCC patients with early stage cancer. Antibodies specific for FABP5 were significantly increased in a substantial amount in patients, suggesting that FABP5 may be a potential diagnostic biomarker for HNSCC. FABP5 may serve as a biomarker for HNSCC.(PMID:19602232)