FABP9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FABP9 Polyclonal antibody (31896-1-AP)

• 

  WB analysis using 31896-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31896-1-AP (FABP9 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 31896-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 31896-1-AP (FABP9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FABP9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31896-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Fatty Acid Binding Protein 9, Fatty acid-binding protein 9, Testis lipid-binding protein, Testis-type fatty acid-binding protein, T-FABP

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31896-1-AP targets FABP9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35224

  Product name: Recombinant human FABP9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-100 aa of NM_001080526

  Sequence: EDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQDTKISFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLG

• Full Name: fatty acid binding protein 9, testis
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: NM_001080526
• Gene Symbol: FABP9
• Gene ID (NCBI): 646480
• RRID: AB_3742489
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q0Z7S8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FABP9 (Fatty Acid-Binding Protein 9) is a cytoplasmic protein and a member of the fatty acid-binding protein superfamily. It is specifically and highly expressed in testicular tissue and plays a critical role in the differentiation of male germ cells. This protein reversibly binds hydrophobic ligands such as fatty acids and retinol, mediating intracellular lipid transport and metabolic regulation. During spermatogenesis, FABP9 maintains the attachment of the acrosome to the sperm nucleus, which is essential for fertilization. Recent studies have revealed that FABP9 is significantly overexpressed in various tumors, including prostate cancer and breast cancer, where it promotes tumor progression through lipid metabolism reprogramming and regulation of the G2/M checkpoint. Its expression is associated with poor patient prognosis, making it a potential diagnostic biomarker and therapeutic target.