FADD Recombinant monoclonal antibody, PBS Only

FADD Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 84619-5-PBS
Clone No.241976A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

241976A11, FAS-associated death domain protein, FAS-associating death domain-containing protein, Growth-inhibiting gene 3 protein, MORT1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84619-5-PBS targets FADD in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6701

Product name: Recombinant human FADD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-208 aa of BC000334

Sequence: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

Predict reactive species
Full Name Fas (TNFRSF6)-associated via death domain
Calculated Molecular Weight 23 kDa
Observed Molecular Weight29 kDa
GenBank Accession NumberBC000334
Gene Symbol FADD
Gene ID (NCBI) 8772
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ13158
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Fas-Associated protein with Death Domain (FADD), also called MORT1 or GIG3, is encoded by the FADD gene. FADD is an adaptor protein that bridges members of the tumor necrosis factor receptor superfamily, such as the Fas-receptor, to procaspases 8 and 10 to form the death-inducing signaling complex (DISC) during apoptosis. As well as its most well known role in apoptosis, FADD has also been seen to play a role in other processes including proliferation, cell cycle regulation and development. FADD has a calculated molecular mass of 23 kDa and always can be detected as 23-30 kDa (PMID: 15390286, 22864571, 17977957)

Loading...
||
New chat Able
正在加载,请稍候...