FADS2 Recombinant monoclonal antibody

• 

  WB analysis of L02 using 84527-4-RR

  L02 cells were subjected to SDS PAGE followed by western blot with 84527-4-RR (FADS2-Specific antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 84527-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84527-4-RR (FADS2-Specific antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 84527-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84527-4-RR (FADS2-Specific antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of L02 using 84527-4-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed L02 cells using FADS2 antibody (84527-4-RR, Clone: 241863D2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 84527-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84527-4-RR against Human FADS2-Specific were performed. The affinity constant is below 1 pM.

FADS2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84527-4-RR

Clone No.241863D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

241863D2, Acyl-CoA 6-desaturase, D6D, Delta-6 desaturase, EC:1.14.19.3

---

Tested Applications

• Positive WB detected in: L02 cells, Jurkat cells, mouse liver tissue, LNCaP cells, A549 cells, PC-3 cells, rat liver tissue
• Positive IF/ICC detected in: L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84527-4-RR targets FADS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27715

  Product name: Recombinant human FADS2-Specific protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-124 aa of BC009011

  Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN

• Full Name: fatty acid desaturase 2
• Calculated Molecular Weight: 445 aa, 49 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC009011
• Gene Symbol: FADS2
• Gene ID (NCBI): 9415
• RRID: AB_3672034
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O95864
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms produced by alternative splicing.