FAF2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• FAF2 Recombinant monoclonal antibody, PBS Only (88402-1-PBS)

FAF2 Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 88402-1-PBS

Clone No.260728B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

ETEA, FAF 2, FAS-associated factor 2, KIAA0887, Protein ETEA

• 

  WB analysis using 88402-1-RR (same clone as 88402-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88402-1-RR (FAF2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88402-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 88402-1-RR (same clone as 88402-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88402-1-RR (FAF2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88402-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 88402-1-RR (same clone as 88402-1-PBS)

  IP result of anti-FAF2 (IP:88402-1-RR, 4ug; Detection:88402-1-RR 1:2000) with HeLa cells lysate 1200 ug. This data was developed using the same antibody clone with 88402-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88402-1-PBS targets FAF2 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33251

  Product name: Recombinant human FAF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-445 aa of BC014001

  Sequence: LKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLASLRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECLPPEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEVLFVQDLTDE

• Full Name: Fas associated factor family member 2
• Calculated Molecular Weight: 445 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC014001
• Gene Symbol: FAF2
• Gene ID (NCBI): 23197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96CS3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protein ETEA (FAF2, or UBXD8) is a homolog to Fas-associated factor 1 (FAF1), which is involved in Fas-mediated apoptosis. ETEA protein directly interacts with and negatively regulates neurofibromin. ETEA contains both UBA and UBX domains and overexpression of ETEA downregulates neurofibromin in human cells. It may play a role in the translocation of terminally misfolded proteins from the endoplasmic reticulum lumen to the cytoplasm and their degradation by the proteasome. ETEA is highly expressed in peripheral blood of patients with atopic dermatitis (AD) compared to normal individuals, and may regulate the resistance to apoptosis that is observed in T cells and eosinophils of AD patients.