FAHD1 Monoclonal antibody, PBS Only (Detector)

FAHD1 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 68624-1-PBS
Clone No.2C7E3

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, Cytometric bead array, Indirect ELISA

FAH domain-containing protein 1, EC:4.1.1.112, EC:3.7.1.5, C16orf36, Acylpyruvase FAHD1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68624-1-PBS targets FAHD1 as part of a matched antibody pair:

MP50475-1: 68624-2-PBS capture and 68624-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23956

Product name: Recombinant human FAHD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 28-226 aa of BC063017

Sequence: ADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLPKVSSATLPVRLQE

Predict reactive species
Full Name fumarylacetoacetate hydrolase domain containing 1
Observed Molecular Weight25-30 kDa
GenBank Accession NumberBC063017
Gene Symbol FAHD1
Gene ID (NCBI) 81889
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ6P587
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Fumarylacetoacetate hydrolase domain containing protein 1 (FAHD1) is a eukaryotic member of the fumarylacetocetate hydrolase (FAH) superfamily of enzymes. It acts as an oxaloacetate decarboxylase (ODx), catalyzing the decarboxylation of oxaloacetate (OAA) to pyruvate and CO2.

Loading...
||
New chat Able
正在加载,请稍候...