FAM108C1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM108C1 Polyclonal antibody (33561-1-AP)

• 

  WB analysis using 33561-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33561-1-AP (FAM108C1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

FAM108C1 Polyclonal Antibody for WB, ELISA

Cat No. 33561-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ABHD17C, Abhydrolase domain-containing protein 17C, Alpha/beta hydrolase domain-containing protein 17C, EC:3.1.2.22

---

Tested Applications

• Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, RT-4 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33561-1-AP targets FAM108C1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37831

  Product name: Recombinant human FAM108C1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-91 aa of BC059401

  Sequence: RMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRGAGASAPAPAQATAAAAAAQPAPQQPEEGAGAGPGACSLHL

• Full Name: family with sequence similarity 108, member C1
• Calculated Molecular Weight: 329 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC059401
• Gene Symbol: FAM108C1
• Gene ID (NCBI): 58489
• RRID: AB_3743008
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6PCB6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.