FAM111B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM111B Polyclonal antibody (29407-1-AP)

FAM111B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29407-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (2)

Applications

WB, IHC, ELISA

Synonyms

CANP, FAM111B, Protein FAM111B

• 

  WB analysis using 29407-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29407-1-AP (FAM111B antibody) at dilution of 1:9000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 29407-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 29407-1-AP (FAM111B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 29407-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 29407-1-AP (FAM111B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FAM111B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HeLa cells, Jurkat cells, MCF-7 cells, SW 1990 cells
• Positive IHC detected in: human lung cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:18000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29407-1-AP targets FAM111B in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29376

  Product name: Recombinant human FAM111B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-465 aa of BC130539

  Sequence: RFRSDIGEFEWKLKEGHKKIYGKQSMVDEVSGKVLEMDISKKKALQQKDIHKKIKQNESATDEINHQSLIQSKKKVHKPKKDGETKDVEHSREQILPPQDLSHYIKDKTRQTIPRIRNYYFCSLPRKYRQINSQVRRRPHLGRRYAINLDVQKEAINLLKNYQTLNEAIMHQYPNFKEEAQWVRKYFREEQKRMNLSPAKQFNIYKKDFGKMTANSVSVATCEQLTYYSKSVGFMQ

• Full Name: family with sequence similarity 111, member B
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC130539
• Gene Symbol: FAM111B
• Gene ID (NCBI): 374393
• RRID: AB_2918299
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6SJ93
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The FAM111B antibody (Cat# 29407-1-AP) has 8 total citations across journals including Cell Oncology, Digestive and Liver Disease, Neoplasia, Medical Oncology, Journal of Clinical Laboratory Analysis, Clinical and Experimental Pharmacology and Physiology, International Journal of General Medicine, and Translational Cancer Research. The research fields span cancer biology, covering esophageal, hepatic, prostate, pancreatic, colorectal, and glioma cancers, with topics including tumorigenesis, metastasis, glycolysis, ferroptosis resistance, and immune microenvironment.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC	Cell Oncol (Dordr); Overexpressed FAM111B degrades GSDMA to promote esophageal cancer tumorigenesis and cisplatin resistance; Authors - Haiqin Wang
human	WB	Dig Liver Dis; Silencing of FAM111B inhibited proliferation, migration and invasion of hepatoma cells through activating p53 pathway; Authors - Feng Li
		Neoplasia; FAM111B enhances glycolysis and promotes metastasis of prostate cancer by upregulating LDHA; Authors - Qingliu He
human	WB	Med Oncol; PRIM2 promotes proliferation and metastasis of pancreatic ductal adenocarcinoma through interactions with FAM111B; Authors - Jingyang Yin
human	IHC	J Clin Lab Anal; Clinicopathological features, prognostic significance, and associated tumor cell functions of family with sequence similarity 111 member B in pancreatic adenocarcinoma; Authors - Qi Gong
human	WB	Clin Exp Pharmacol Physiol; The ELF1/IGF2BP2/FAM111B Cascade Drives Colorectal Cancer Progression and Ferroptosis Resistance.; Authors - Dian Yin ; KD Validated