FAM111B Polyclonal antibody

• 

  WB analysis using 29407-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29407-1-AP (FAM111B antibody) at dilution of 1:9000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 29407-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 29407-1-AP (FAM111B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 29407-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 29407-1-AP (FAM111B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM111B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29407-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (2)

Applications

WB, IHC, ELISA

Synonyms

CANP, FAM111B, Protein FAM111B

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HeLa cells, Jurkat cells, MCF-7 cells, SW 1990 cells
• Positive IHC detected in: human lung cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:18000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 2 publications below

Product Information

29407-1-AP targets FAM111B in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29376

  Product name: Recombinant human FAM111B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-465 aa of BC130539

  Sequence: RFRSDIGEFEWKLKEGHKKIYGKQSMVDEVSGKVLEMDISKKKALQQKDIHKKIKQNESATDEINHQSLIQSKKKVHKPKKDGETKDVEHSREQILPPQDLSHYIKDKTRQTIPRIRNYYFCSLPRKYRQINSQVRRRPHLGRRYAINLDVQKEAINLLKNYQTLNEAIMHQYPNFKEEAQWVRKYFREEQKRMNLSPAKQFNIYKKDFGKMTANSVSVATCEQLTYYSKSVGFMQ

• Full Name: family with sequence similarity 111, member B
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC130539
• Gene Symbol: FAM111B
• Gene ID (NCBI): 374393
• RRID: AB_2918299
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6SJ93
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Med Oncol; PRIM2 promotes proliferation and metastasis of pancreatic ductal adenocarcinoma through interactions with FAM111B; Authors - Jingyang Yin
human	WB	Int J Gen Med; Pan-Cancer Analysis of the Tumorigenic Effect and Prognostic Diagnostic Value of FAM111B in Human Carcinomas; Authors - Hengmiao Wu
human	WB	Dig Liver Dis; Silencing of FAM111B inhibited proliferation, migration and invasion of hepatoma cells through activating p53 pathway; Authors - Feng Li
human,mouse	WB,IHC	Cell Oncol (Dordr); Overexpressed FAM111B degrades GSDMA to promote esophageal cancer tumorigenesis and cisplatin resistance; Authors - Haiqin Wang
human	IHC	J Clin Lab Anal; Clinicopathological features, prognostic significance, and associated tumor cell functions of family with sequence similarity 111 member B in pancreatic adenocarcinoma; Authors - Qi Gong