FAM128B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM128B Polyclonal antibody (33491-1-AP)

• 

  WB analysis using 33491-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33491-1-AP (FAM128B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

FAM128B Polyclonal Antibody for WB, ELISA

Cat No. 33491-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Mitotic-spindle organizing protein 2B, Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B, MOZART2B, MZT2B

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33491-1-AP targets FAM128B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38628

  Product name: Recombinant human FAM128B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-158 aa of BC066296

  Sequence: MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST

• Full Name: family with sequence similarity 128, member B
• Observed Molecular Weight: 16-20 kDa
• GenBank Accession Number: BC066296
• Gene Symbol: FAM128B
• Gene ID (NCBI): 80097
• RRID: AB_3742991
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6NZ67
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.