FAM134B Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• FAM134B Recombinant monoclonal antibody, PBS Only (84773-3-PBS)

• 

  WB analysis using 84773-3-RR (same clone as 84773-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84773-3-RR (FAM134B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84773-3-PBS in a different storage buffer formulation.

• 

  WB analysis using 84773-3-RR (same clone as 84773-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84773-3-RR (FAM134B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84773-3-PBS in a different storage buffer formulation.

• 

  Affinity of 84773-3-RR

  Biolayer interferometry (BLI) kinetic assays of 84773-3-RR against Human FAM134B were performed. The affinity constant is 0.733 nM.

FAM134B Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84773-3-PBS

Clone No.260027B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

JK1, Reticulophagy receptor 1, Reticulophagy regulator 1, RETREG1

---

Product Information

84773-3-PBS targets FAM134B in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16176

  Product name: Recombinant human FAM134B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 282-455 aa of BC030517

  Sequence: ELDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDF

• Full Name: family with sequence similarity 134, member B
• Calculated Molecular Weight: 497 aa, 55 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC030517
• Gene Symbol: FAM134B
• Gene ID (NCBI): 54463
• RRID: AB_3743721
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H6L5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM134B, also known as the reticulophagy regulator 1 (RETREG1) or JK-1, is a member of the family with sequence similarity 134. FAM134B is an important ER-phagy receptor. FAM134B regulates the size and shape of the ER and participates in some ER-phagy-related processes(PMID: 33199694). FAM134B inhibition contributes to impair proteostasis in the ER due to the accumulation of misfolded or aggregated proteins, which in turn leads to compromised neuronal survival and progressive neuronal degenerative diseases. In addition, FAM134B mutations are common in patients with colorectal adenocarcinoma, and oesophageal squamous cell carcinoma(PMID: 29226326).