FAM155A Polyclonal antibody

• 

  WB analysis of K-562 using 24929-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 24929-1-AP (FAM155A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 24929-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 24929-1-AP (FAM155A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 24929-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24929-1-AP (FAM155A Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 24929-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24929-1-AP (FAM155A Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 24929-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24929-1-AP (FAM155A Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 24929-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24929-1-AP (FAM155A Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM155A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24929-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

FAM155A, Transmembrane protein FAM155A

---

Tested Applications

• Positive WB detected in: K-562 cells, COLO 320 cells
• Positive IHC detected in: human colon cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24929-1-AP targets FAM155A in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21575

  Product name: Recombinant human FAM155A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 58-272 aa of BC157830

  Sequence: FCAEAKLTRARDKEHQQQQRQQQQQQQQQRQRQQQQQQRRQQEPSWPALLASMGESSPAAQAHRLLSASSSPTLPPSPGDGGGGGGKGNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPLWNLSDFYLSFCNSYTLWELFSGLSSPNTLNCSLDVVLKEGGEMTTCRQCVEAYQDYD

• Full Name: family with sequence similarity 155, member A
• Calculated Molecular Weight: 458 aa, 51 kDa
• Observed Molecular Weight: 49-55 kDa
• GenBank Accession Number: BC157830
• Gene Symbol: FAM155A
• Gene ID (NCBI): 728215
• RRID: AB_2879803
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: B1AL88
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM155A is a transmembrane protein with glycosylation. The MW is from 49-55 kDa.