FAM161A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM161A Polyclonal antibody, PBS Only (32256-1-PBS)

• 

  WB analysis using 32256-1-AP (same clone as 32256-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32256-1-AP (FAM161A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32256-1-PBS in a different storage buffer formulation.

FAM161A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32256-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

Protein FAM161A

---

Product Information

32256-1-PBS targets FAM161A in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35562

  Product name: Recombinant human FAM161A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 477-618 aa of BC107163

  Sequence: SSRGREQAVRKSEKERMREYQRELEEREEKLKKRPLLFERVAQKNARMAAEKHYSNTLKALGISDEFVSKKGQSGKVLEYFNNQETKSVTEDKESFNEEEKIEERENGEENYFIDTNSQDSYKEKDEANEESEEEKSVEESH

• Full Name: family with sequence similarity 161, member A
• Calculated Molecular Weight: 716 aa, 83 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC107163
• Gene Symbol: FAM161A
• Gene ID (NCBI): 84140
• RRID: AB_3670230
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q3B820
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.