FAM172A Polyclonal antibody

FAM172A Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24732-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

C5orf21, FAM172A, Protein FAM172A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse colon tissue, rat colon tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24732-1-AP targets FAM172A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20437

Product name: Recombinant human FAM172A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 202-416 aa of BC020584

Sequence: NYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL

Predict reactive species
Full Name family with sequence similarity 172, member A
Calculated Molecular Weight 416 aa, 48 kDa
Observed Molecular Weight50-55 kDa
GenBank Accession NumberBC020584
Gene Symbol FAM172A
Gene ID (NCBI) 83989
RRIDAB_2923572
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WUF8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Family with sequence similarity 172 member A (FAM172A), cloned from human aortic tissues, is subsequently observed in human endothelial and vascular smooth muscle cells, and macrophages. As the imbalance of the cell cycle and apoptosis is closely related to the key characteristics of malignant tumors, FAM172A dysregulation is a potential contributing factor in cell transformation. Recently, FAM172A has been reported to take part in the development of several cancers, such as human liver, colorectal and papillary thyroid cancers. Moreover, FAM172A was upregulated by high glucose in a concentration- and time-dependent manner which indicated that FAM172A may be involved in the pathogenesis of diabetic related diseases. FAM172A has 4 isoforms with the molecular mass of 34-36, 43 and 48 kDa. This antibody was detected at 50-55 kDa on SDS-PAGE. (PMID: 31988090, 26637224)

Protocols

Product Specific Protocols
IHC protocol for FAM172A antibody 24732-1-APDownload protocol
WB protocol for FAM172A antibody 24732-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...