FAM173A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM173A Polyclonal antibody (32901-1-AP)

• 

  IHC staining of mouse kidney using 32901-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32901-1-AP (FAM173A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 32901-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32901-1-AP (FAM173A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM173A Polyclonal Antibody for IHC, ELISA

Cat No. 32901-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

Adenine nucleotide translocase lysine N-methyltransferase, ANTKMT , ANT-KMT, C16orf24, EC:2.1.1.-

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32901-1-AP targets FAM173A in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37690

  Product name: Recombinant human FAM173A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-235 aa of BC001181

  Sequence: QPGFRRVPLRLQVPYVGASARQVEHVLSLLRGRPGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVALARLHAWRAGCAGSVCYRRKDLWKVSLRDCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAASSRIPIQAAPGPSSAPIPGGLISQAS

• Full Name: family with sequence similarity 173, member A
• Calculated Molecular Weight: 235 aa, 25 kDa
• GenBank Accession Number: BC001181
• Gene Symbol: FAM173A
• Gene ID (NCBI): 65990
• RRID: AB_3742781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BQD7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANTKMT (FAM173A) encodes adenine nucleotide translocase lysine methyltransferase, a protein-lysine methyltransferase that carries out peptidyl-lysine trimethylation. It is a member of the 7BS protein lysine methyltransferase and ANT/ATPSC lysine N-methyltransferase families. The protein localizes to the mitochondrion, mitochondrial membrane, cytosol, and membrane, placing it in compartments relevant to mitochondrial energy metabolism.